A2BP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• A2BP1 Polyclonal antibody, PBS Only (22647-1-PBS)

• 

  WB analysis using 22647-1-AP (same clone as 22647-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22647-1-AP (A2BP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  IP result of anti-A2BP1 (IP:22647-1-AP, 4ug; Detection:22647-1-AP 1:500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22647-1-AP (A2BP1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22647-1-AP (A2BP1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using A2BP1 antibody (22647-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using A2BP1 antibody (22647-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 22647-1-AP (same clone as 22647-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using A2BP1 antibody (22647-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22647-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

A2BP1 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 22647-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

FOX1, RBFOX1, HRNBP1, Hexaribonucleotide-binding protein 1, Fox-1 homolog A

---

Product Information

22647-1-PBS targets A2BP1 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18527

  Product name: Recombinant human A2BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC113691

  Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE

• Full Name: ataxin 2-binding protein 1
• Calculated Molecular Weight: 395 aa, 42 kDa
• Observed Molecular Weight: 45-70 kDa
• GenBank Accession Number: BC113691
• Gene Symbol: A2BP1
• Gene ID (NCBI): 54715
• RRID: AB_2879142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

A2BP1, also named as FOX1 and HRNBP1, contains one RRM (RNA recognition motif) domain. A2BP1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. A2BP1 and ataxin-2 are both localized in the trans-Golgi network. This is a rabbit polyclonal antibody raised against the N terminus of human A2BP1.A2BP1 has two mouse isoforms (A2BP1-A016 and -A030) exogenously expressed in COS7 cells showed a molecular mass of 65 kDa, although the calculated molecular masses of A016 and A030 are 40 and 42 kDa, respectively in the course of cell biological study.