A2BP1 Recombinant monoclonal antibody, PBS Only (Capture)

A2BP1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85732-2-PBS
Clone No.243149B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

FOX1, RBFOX1, A2BP, Ataxin-2-binding protein 1, Fox-1 homolog A

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85732-2-PBS targets A2BP1 as part of a matched antibody pair:

MP02075-1: 85732-2-PBS capture and 85732-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18527

Product name: Recombinant human A2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-128 aa of BC113691

Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE

Predict reactive species
Full Name ataxin 2-binding protein 1
Calculated Molecular Weight 395 aa, 42 kDa
Observed Molecular Weight 45-60 kDa
GenBank Accession NumberBC113691
Gene Symbol A2BP1
Gene ID (NCBI) 54715
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NWB1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

A2BP1, also named as FOX1 and HRNBP1, contains one RRM (RNA recognition motif) domain. A2BP1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. A2BP1 and ataxin-2 are both localized in the trans-Golgi network.

Loading...
||
New chat Able
正在加载,请稍候...