AADACL1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AADACL1 Recombinant monoclonal antibody (87679-2-RR)

• 

  WB analysis using 87679-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87679-2-RR (AADACL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

AADACL1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87679-2-RR

Clone No.253123B2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

2-acetyl MAGE hydrolase, AADACL 1, Acetylalkylglycerol acetylhydrolase, Arylacetamide deacetylase-like 1, EC:3.1.1.-

---

Tested Applications

• Positive WB detected in: PC-3 cells, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87679-2-RR targets AADACL1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5136

  Product name: Recombinant human AADACL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 83-435 aa of BC047588

  Sequence: SHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL

• Full Name: arylacetamide deacetylase-like 1
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC047588
• Gene Symbol: AADACL1
• Gene ID (NCBI): 57552
• RRID: AB_3745693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PIU2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AADACL1(Arylacetamide deacetylase-like 1) is also named as NCEH1, KIAA1363 and belongs to the 'GDXG' lipolytic enzyme family. The transmembrane enzyme, AADACL1, controls the production of the monoalkylglycerol ether (MAGE) class of NELs in cancer cells and acts as a 2-acetyl MAGE hydrolase and is likely the principal source for this activity in tumor cells(PMID:21513884). The full length protein has three glycosylation sites and can be N-glycosylated(PMID:19159218). It has 3 isoforms produced by alternative splicing.