Product Information
29354-1-PBS targets AASS in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29520 Product name: Recombinant human AASS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 33-146 aa of NM_005763 Sequence: VNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVR Predict reactive species |
| Full Name | aminoadipate-semialdehyde synthase |
| Calculated Molecular Weight | 102 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | NM_005763 |
| Gene Symbol | AASS |
| Gene ID (NCBI) | 10157 |
| RRID | AB_3742311 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UDR5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Aminoadipate-semialdehyde synthase (AASS) is a bifunctional enzyme catalyzing the first two steps of lysine degradation via the saccharopine pathway. It possesses both lysine-ketoglutarate reductase and saccharopine dehydrogenase activities. Mutations in the AASS gene cause familial hyperlysinemia, a rare autosomal recessive disorder characterized by elevated plasma lysine levels, though clinical manifestations are typically benign. AASS dysfunction disrupts mitochondrial energy metabolism and amino acid homeostasis. Beyond its metabolic role, emerging evidence suggests AASS may influence cellular redox status and autophagy regulation, positioning it as a potential therapeutic target for metabolic disorders and lysine-related pathologies (PMID: 41158987; 10775527).















