Home
Products
Primary Antibodies
AASS Polyclonal antibody, PBS Only (29354-1-PBS)

Filter: AllWBIPIHC

WB analysis using 29354-1-AP (same clone as 29354-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 29354-1-AP (AASS antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.
IP experiment of mouse liver using 29354-1-AP (same clone as 29354-1-PBS)
IP result of anti-AASS (IP:29354-1-AP, 4ug; Detection:29354-1-AP 1:3000) with mouse liver tissue lysate 2480 ug. This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 29354-1-AP (same clone as 29354-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 29354-1-AP (same clone as 29354-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 29354-1-AP (same clone as 29354-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 29354-1-AP (same clone as 29354-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29354-1-PBS in a different storage buffer formulation.

AASS Polyclonal antibody, PBS Only

Name: AASS Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 29354-1-PBS

AASS Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 29354-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

LKR, LKR/SDH, LKRSDH, LOR, LORSDH

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

29354-1-PBS targets AASS in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag29520 Product name: Recombinant human AASS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 33-146 aa of NM_005763 Sequence: VNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVR Predict reactive species
Full Name	aminoadipate-semialdehyde synthase
Calculated Molecular Weight	102 kDa
Observed Molecular Weight	100-110 kDa
GenBank Accession Number	NM_005763
Gene Symbol	AASS
Gene ID (NCBI)	10157
RRID	AB_3742311
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UDR5
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Aminoadipate-semialdehyde synthase (AASS) is a bifunctional enzyme catalyzing the first two steps of lysine degradation via the saccharopine pathway. It possesses both lysine-ketoglutarate reductase and saccharopine dehydrogenase activities. Mutations in the AASS gene cause familial hyperlysinemia, a rare autosomal recessive disorder characterized by elevated plasma lysine levels, though clinical manifestations are typically benign. AASS dysfunction disrupts mitochondrial energy metabolism and amino acid homeostasis. Beyond its metabolic role, emerging evidence suggests AASS may influence cellular redox status and autophagy regulation, positioning it as a potential therapeutic target for metabolic disorders and lysine-related pathologies (PMID: 41158987; 10775527).