• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated AATF Monoclonal antibody

AATF Monoclonal Antibody for FC (Intra)
Cat No. CL488-67868
Clone No.2A6G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

Protein AATF, HSPC277, DED, CHE1, CHE 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67868 targets AATF in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0195

Product name: Recombinant human AATF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-212 aa of BC000591

Sequence: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTF

Predict reactive species
Full Name apoptosis antagonizing transcription factor
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 80-90 kDa
GenBank Accession NumberBC000591
Gene Symbol AATF
Gene ID (NCBI) 26574
RRIDAB_2923810
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NY61
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Apoptosis antagonizing transcription factor (AATF), an interacting partner of RNA polymerase II is a multifunctional protein that is highly conserved in eukaryotes. In addition to nuclear hormone receptors, AATF has been shown to interact with several transcription factors, including the retinoblastoma protein (pRb), p65, and STAT3(PMID: 34785906). Furthermore AATF serves as a critical regulator in various cancers and promotes tumorigenesis by protecting cancer cells from apoptosis induction, favoring cell proliferation, or promoting cell survival by autophagy(PMID: 33145763).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 AATF antibody CL488-67868Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...