• Featured Product
  • KD/KO Validated

ABCA1 Polyclonal antibody

ABCA1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26564-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

ABC1, ABC-1, ATP-binding cassette 1, ATP-binding cassette sub-family A member 1, ATP-binding cassette transporter 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue
Positive IHC detected inmouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26564-1-AP targets ABCA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24118

Product name: Recombinant human ABCA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 92-272 aa of BC141816

Sequence: GVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPKEKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQEM

Predict reactive species
Full Name ATP-binding cassette, sub-family A (ABC1), member 1
Calculated Molecular Weight 2261 aa, 254 kDa
Observed Molecular Weight250 kDa
GenBank Accession NumberBC141816
Gene Symbol ABCA1
Gene ID (NCBI) 19
RRIDAB_3085884
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95477
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABCA, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway.

Protocols

Product Specific Protocols
IHC protocol for ABCA1 antibody 26564-1-APDownload protocol
WB protocol for ABCA1 antibody 26564-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Clin Transl Med

Tumour-associated macrophage-derived DOCK7-enriched extracellular vesicles drive tumour metastasis in colorectal cancer via the RAC1/ABCA1 axis

Authors - Weiwei Chen
  • KD Validated
mouse,humanWB,IHC

Phytomedicine

Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux

Authors - Jianfei Mu
mouseWB,IHC

Atherosclerosis

Flagellar hook protein FlgE promotes macrophage activation and atherosclerosis by targeting ATP5B

Authors - Yuanyuan Li
humanIF

Front Cardiovasc Med

miR-3529-3p/ABCA1 axis regulates smooth muscle cell homeostasis by enhancing inflammation via JAK2/STAT3 pathway

Authors - Tingyu Wang
humanIHC

Biofactors

Investigating the dysregulation of genes associated with glucose and lipid metabolism in gastric cancer and their influence on immunity and prognosis

Authors - Yan Li
mouseWB

Drug Des Devel Ther

Baolier Capsule's Secret Weapon: Piperine Boosts Cholesterol Excretion to Combat Atherosclerosis

Authors - Mengqiu Wei
Loading...
||
New chat Able
正在加载,请稍候...