ABCA1 Polyclonal antibody, PBS Only

• 

  WB analysis using 26564-1-AP (same clone as 26564-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26564-1-AP (ABCA1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26564-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26564-1-AP (same clone as 26564-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26564-1-AP (ABCA1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 26564-1-AP (same clone as 26564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 26564-1-AP (ABCA1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26564-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ABCA1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26564-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ABC1, ABC-1, ATP-binding cassette 1, ATP-binding cassette sub-family A member 1, ATP-binding cassette transporter 1

---

Product Information

26564-1-PBS targets ABCA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24118

  Product name: Recombinant human ABCA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-272 aa of BC141816

  Sequence: GVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPKEKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQEM

• Full Name: ATP-binding cassette, sub-family A (ABC1), member 1
• Calculated Molecular Weight: 2261 aa, 254 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC141816
• Gene Symbol: ABCA1
• Gene ID (NCBI): 19
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95477
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABCA, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway.