Home
Products
Primary Antibodies
ABCA8 Polyclonal antibody, PBS Only (24351-1-PBS)

Filter: AllWBIHC

WB analysis of mouse brain using 24351-1-AP (same clone as 24351-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 24351-1-AP (ABCA8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24351-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 24351-1-AP (same clone as 24351-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24351-1-AP (ABCA8 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24351-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 24351-1-AP (same clone as 24351-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24351-1-AP (ABCA8 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24351-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 24351-1-AP (same clone as 24351-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24351-1-AP (ABCA8 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24351-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 24351-1-AP (same clone as 24351-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24351-1-AP (ABCA8 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24351-1-PBS in a different storage buffer formulation.

ABCA8 Polyclonal antibody, PBS Only

Name: ABCA8 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24351-1-PBS

ABCA8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24351-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ABC-type organic anion transporter ABCA8, ATP-binding cassette sub-family A member 8, EC:7.6.2.-, KIAA0822

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24351-1-PBS targets ABCA8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18991 Product name: Recombinant human ABCA8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 58-184 aa of bc130280 Sequence: SLLTMDLGRVDTFNESRFSVVYTPVTNTTQQIMNKVASTPFLAGKEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVALQAAI Predict reactive species
Full Name	ATP-binding cassette, sub-family A (ABC1), member 8
Calculated Molecular Weight	1581 aa, 179 kDa
Observed Molecular Weight	160-180 kDa
GenBank Accession Number	bc130280
Gene Symbol	ABCA8
Gene ID (NCBI)	10351
RRID	AB_2879504
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O94911
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.