Use Able AI chat for product recommendations

ABCE1 Monoclonal antibody

ABCE1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67960-1-Ig
Clone No. 1B7E8
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

1B7E8, 2'-5'-oligoadenylate-binding protein, ATP-binding cassette sub-family E member 1, EC:3.6.5.-, OK/SW-cl.40

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ABCE1 in ?

Tested Applications

Positive WB detected inHepG2 cells, A431 cells, U2OS cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67960-1-Ig targets ABCE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28493

Product name: Recombinant human ABCE1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 76-256 aa of BC016283

Sequence: PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA

Predict reactive species
Full Name ATP-binding cassette, sub-family E (OABP), member 1
Calculated Molecular Weight 599 aa, 67 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC016283
Gene Symbol ABCE1
Gene ID (NCBI) 6059
RRIDAB_2918711
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61221
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCE1 is an ATPase that is a member of the ATP-binding cassette (ABC) transporters superfamily and OABP subfamily, it is an essential and highly conserved protein that is required for both eukaryotic translation initiation as well as ribosome biogenesis.

Protocols

Product Specific Protocols
IF protocol for ABCE1 antibody 67960-1-IgDownload protocol
IHC protocol for ABCE1 antibody 67960-1-IgDownload protocol
WB protocol for ABCE1 antibody 67960-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is negative (1/5 stars). The reviewer reported that the antibody failed to work in Western Blot across multiple cell extracts (HeLa, HEK293T, MT4), on both PVDF and nitrocellulose membranes, with various dilutions and blocking buffers. Overall, the reviewer found the antibody non-functional for their intended application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Daniel (Verified Customer) (10-26-2022)

This antibody does not work in any cell extract tested. It doesn't work in PVDF or nitrocellulose, multiple dilution and different blocking buffers.

  • Applications: Western Blot
  • Cell Tissue Type: HeLa, HEK293T, MT4 cells
Loading...
||
New chat

Able™

正在加载,请稍候...