CoraLite®594-conjugated ABCE1 Monoclonal antibody

ABCE1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67960
Clone No.1B7E8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

RLI, OK/SW-cl.40, EC:3.6.5.-, ATP-binding cassette sub-family E member 1, 2'-5'-oligoadenylate-binding protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67960 targets ABCE1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28493

Product name: Recombinant human ABCE1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 76-256 aa of BC016283

Sequence: PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA

Predict reactive species
Full Name ATP-binding cassette, sub-family E (OABP), member 1
Calculated Molecular Weight 599 aa, 67 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC016283
Gene Symbol ABCE1
Gene ID (NCBI) 6059
RRIDAB_2923935
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61221
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ABCE1 is an ATPase that is a member of the ATP-binding cassette (ABC) transporters superfamily and OABP subfamily, it is an essential and highly conserved protein that is required for both eukaryotic translation initiation as well as ribosome biogenesis.

Protocols

Product Specific Protocols
IF protocol for CL594 ABCE1 antibody CL594-67960Download protocol
FC protocol for CL594 ABCE1 antibody CL594-67960Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...