CoraLite®594-conjugated ABCE1 Monoclonal antibody

• 

  IF Staining of HeLa using CL594-67960

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 ABCE1 antibody (CL594-67960, Clone: 1B7E8 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-67960

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human ABCE1 (CL594-67960, Clone:1B7E8) (red), or 0.4 ug Mouse IgG2b Isotype Control (CL594-66360-3, Clone: K11B8C4B5) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

ABCE1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67960

Clone No.1B7E8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

RLI, OK/SW-cl.40, EC:3.6.5.-, ATP-binding cassette sub-family E member 1, 2'-5'-oligoadenylate-binding protein

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67960 targets ABCE1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28493

  Product name: Recombinant human ABCE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 76-256 aa of BC016283

  Sequence: PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA

• Full Name: ATP-binding cassette, sub-family E (OABP), member 1
• Calculated Molecular Weight: 599 aa, 67 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC016283
• Gene Symbol: ABCE1
• Gene ID (NCBI): 6059
• RRID: AB_2923935
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61221
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ABCE1 is an ATPase that is a member of the ATP-binding cassette (ABC) transporters superfamily and OABP subfamily, it is an essential and highly conserved protein that is required for both eukaryotic translation initiation as well as ribosome biogenesis.