ABCG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ABCG5 Polyclonal antibody, PBS Only (27722-1-PBS)

• 

  WB analysis using 27722-1-AP (same clone as 27722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27722-1-AP (same clone as 27722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27722-1-AP (same clone as 27722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 27722-1-AP (same clone as 27722-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 27722-1-AP (same clone as 27722-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 27722-1-AP (same clone as 27722-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27722-1-PBS in a different storage buffer formulation.

ABCG5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27722-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Sterolin 1, STSL

---

Product Information

27722-1-PBS targets ABCG5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26844

  Product name: Recombinant human ABCG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of NM_022436

  Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 5
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 68 kDa~72 kDa
• GenBank Accession Number: NM_022436
• Gene Symbol: ABCG5
• Gene ID (NCBI): 64240
• RRID: AB_2880952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H222
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABCG5 belongs to the ABC transporter subfamily, whose members are "half-transporters" that require the formation of homodimers or heterodimers to function(PMID: 14504269). ABCG5 and ABCG8 form an obligate heterodimer that limits intestinal absorption and facilitates biliary secretion of cholesterol and phytosterols(PMID: 24252657). Mutations in ABCG5e may contribute to sterol accumulation and atherosclerosis(PMID: 15054092).