ABHD12B Polyclonal antibody

• 

  WB analysis of mouse skin using 20623-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 20623-1-AP (ABHD12B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 20623-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20623-1-AP (ABHD12B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin using 20623-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20623-1-AP (ABHD12B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 20623-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20623-1-AP (ABHD12B antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 20623-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20623-1-AP (ABHD12B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 20623-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20623-1-AP (ABHD12B antibody) at dilution of 1:50 (under 40x lens).

ABHD12B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20623-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ABHD12B, BEM46L3, c14_5314, C14orf29

---

Tested Applications

• Positive WB detected in: mouse skin tissue, mouse kidney tissue
• Positive IHC detected in: human skin tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20623-1-AP targets ABHD12B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14426

  Product name: Recombinant human ABHD12B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC034603

  Sequence: MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS

• Full Name: abhydrolase domain containing 12B
• Calculated Molecular Weight: 362 aa, 41 kDa
• Observed Molecular Weight: 41 kDa, 29 kDa
• GenBank Accession Number: BC034603
• Gene Symbol: ABHD12B
• Gene ID (NCBI): 145447
• RRID: AB_10693623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z5M8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.