ABHD14B Polyclonal antibody

• 

  WB analysis of L02 using 20952-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 20952-1-AP (ABHD14B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 20952-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 20952-1-AP (ABHD14B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate hyperplasia using 20952-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 20952-1-AP (ABHD14B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 20952-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 20952-1-AP (ABHD14B antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 20952-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 20952-1-AP (ABHD14B antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 20952-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 20952-1-AP (ABHD14B antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 20952-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ABHD14B antibody (20952-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

ABHD14B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20952-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Putative protein-lysine deacylase ABHD14B, EC:2.3.1.-, CIB, CCG1-interacting factor B, Alpha/beta hydrolase domain-containing protein 14B

---

Tested Applications

• Positive WB detected in: L02 cells, mouse small intestine tissue
• Positive IHC detected in: human prostate hyperplasia tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20952-1-AP targets ABHD14B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15097

  Product name: Recombinant human ABHD14B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC007234

  Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

• Full Name: abhydrolase domain containing 14B
• Calculated Molecular Weight: 210 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC007234
• Gene Symbol: ABHD14B
• Gene ID (NCBI): 84836
• RRID: AB_10733758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IU4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.