ACAD8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACAD8 Polyclonal antibody, PBS Only (16742-1-PBS)

• 

  WB analysis of mouse pancreas using 16742-1-AP (same clone as 16742-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16742-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 16742-1-AP (same clone as 16742-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16742-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 16742-1-AP (same clone as 16742-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16742-1-PBS in a different storage buffer formulation.

ACAD8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16742-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16742-1-PBS targets ACAD8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9967

  Product name: Recombinant human ACAD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-415 aa of BC001964

  Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

• Full Name: acyl-Coenzyme A dehydrogenase family, member 8
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC001964
• Gene Symbol: ACAD8
• Gene ID (NCBI): 27034
• RRID: AB_2219559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKU7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The acyl-CoA dehydrogenases (ACAD) (EC 1.3.99) are a family of nuclear-encoded mitochondrial enzymes involved in the metabolism of fatty acids and branched chain amino acids (PMID: 13295225). The eighth member of this family, ACAD8, catalyzes the conversion of isobutyryl-CoA to methacrylyl-CoA in valine catabolism (PMID: 12359132). ACAD8, also named as acyl-Coenzyme A dehydrogenase family, member 8, has 3 isoform which molecular weight is 45, 31 and 38 kDa.