ACBD3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACBD3 Polyclonal antibody, PBS Only (14096-1-PBS)

• 

  WB analysis using 14096-1-AP (same clone as 14096-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 14096-1-AP (same clone as 14096-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 14096-1-AP (same clone as 14096-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 14096-1-AP (ACBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14096-1-AP (same clone as 14096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14096-1-AP (same clone as 14096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14096-1-AP (ACBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14096-1-AP (same clone as 14096-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14096-1-AP (ACBD3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14096-1-PBS in a different storage buffer formulation.

ACBD3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14096-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14096-1-PBS targets ACBD3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5228

  Product name: Recombinant human ACBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 229-528 aa of BC060792

  Sequence: RRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANRPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

• Full Name: acyl-Coenzyme A binding domain containing 3
• Calculated Molecular Weight: 528 aa, 61 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC060792
• Gene Symbol: ACBD3
• Gene ID (NCBI): 64746
• RRID: AB_2220062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3P7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.