Product Information
33855-1-PBS targets ACBD7 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40829 Product name: Recombinant human ACBD7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC029526 Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI Predict reactive species |
| Full Name | acyl-Coenzyme A binding domain containing 7 |
| Calculated Molecular Weight | 88 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC029526 |
| Gene Symbol | ACBD7 |
| Gene ID (NCBI) | 414149 |
| RRID | AB_3743096 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N6N7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
