ACIN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACIN1 Polyclonal antibody, PBS Only (23937-1-PBS)

• 

  WB analysis using 23937-1-AP (same clone as 23937-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23937-1-AP (ACIN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23937-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 23937-1-AP (same clone as 23937-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 23937-1-AP (ACIN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23937-1-PBS in a different storage buffer formulation.

ACIN1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23937-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

23937-1-PBS targets ACIN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21036

  Product name: Recombinant human ACIN1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 979-1328 aa of BC140805

  Sequence: TIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR

• Full Name: apoptotic chromatin condensation inducer 1
• Calculated Molecular Weight: 1341 aa, 152 kDa
• Observed Molecular Weight: 250 kDa, 80-85 kDa
• GenBank Accession Number: BC140805
• Gene Symbol: ACIN1
• Gene ID (NCBI): 22985
• RRID: AB_3085716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKV3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. ACIN1 is a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. There are three isoforms of human acinus (the L, S and S' forms) shows at about 80-85 kDa and 220-250 kDa by Western Blot, which were probably generated by alternative splicing (PMID: 10490026). 23937-1-AP can detect all three isoforms of ACIN1. Another antibody 30522-1-AP specificly targets at the ACIN1-L.