Product Information
20410-1-PBS targets ACN9 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species |
| Full Name | ACN9 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 125 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC022858 |
| Gene Symbol | ACN9 |
| Gene ID (NCBI) | 57001 |
| RRID | AB_3085604 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRP4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

