ACN9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACN9 Polyclonal antibody, PBS Only (20410-1-PBS)

• 

  WB analysis using 20410-1-AP (same clone as 20410-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20410-1-AP (ACN9 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20410-1-PBS in a different storage buffer formulation.

ACN9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20410-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20410-1-PBS targets ACN9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14242

  Product name: Recombinant human ACN9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-125 aa of BC022858

  Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF

• Full Name: ACN9 homolog (S. cerevisiae)
• Calculated Molecular Weight: 125 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC022858
• Gene Symbol: ACN9
• Gene ID (NCBI): 57001
• RRID: AB_3085604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.