Aconitase 2 Monoclonal antibody

Aconitase 2 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67509-1-Ig
Clone No.1F1G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), ELISA

ACO2, Citrate hydro-lyase, Aconitase2, Aconitase, ACO 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, pig brain tissue, rat brain tissue, mouse brain tissue, HEK-293 cells, pig cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue, Neuro-2a cells, rabbit brain tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67509-1-Ig targets Aconitase 2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17784

Product name: Recombinant human ACO2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-306 aa of BC014092

Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

Predict reactive species
Full Name aconitase 2, mitochondrial
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 85 kDa
GenBank Accession NumberBC014092
Gene Symbol ACO2
Gene ID (NCBI) 50
RRIDAB_2882730
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99798
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).

Protocols

Product Specific Protocols
WB protocol for Aconitase 2 antibody 67509-1-IgDownload protocol
IHC protocol for Aconitase 2 antibody 67509-1-IgDownload protocol
FC protocol for Aconitase 2 antibody 67509-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...