ACOT12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACOT12 Polyclonal antibody, PBS Only (17871-1-PBS)

• 

  WB analysis using 17871-1-AP (same clone as 17871-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17871-1-AP (ACOT12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17871-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17871-1-AP (same clone as 17871-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17871-1-AP (ACOT12 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17871-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 17871-1-AP (same clone as 17871-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using ACOT12 antibody (17871-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17871-1-PBS in a different storage buffer formulation.

ACOT12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17871-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Acetyl-coenzyme A thioesterase, ACOT 12, Acyl-CoA thioester hydrolase 12, Acyl-CoA thioesterase 12, Acyl-coenzyme A thioesterase 12

---

Product Information

17871-1-PBS targets ACOT12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12355

  Product name: Recombinant human ACOT12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-555 aa of BC075011

  Sequence: MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF

• Full Name: acyl-CoA thioesterase 12
• Calculated Molecular Weight: 555 aa, 62 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC075011
• Gene Symbol: ACOT12
• Gene ID (NCBI): 134526
• RRID: AB_3741940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WYK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACOT12 is an acyl-coenzyme A thioesterase that hydrolyzes acyl-coenzyme A (acyl-CoA) to free fatty acids and coenzyme A, thereby regulating intracellular levels of acyl-CoA and free fatty acids. It plays a key role in lipid metabolism and is mainly expressed in the kidney, liver, and intestine. ACOT12 plays an important role in a variety of diseases, including renal fibrosis, nonalcoholic fatty liver disease (NAFLD), and hepatocellular carcinoma. In renal fibrosis, downregulation of ACOT12 expression leads to lipid accumulation and exacerbates the fibrotic process. Restoration of its expression ameliorates renal fibrosis, suggesting that ACOT12 is a potential therapeutic target.