ACOT9 Monoclonal antibody

• 

  WB analysis using 66532-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66532-1-Ig (ACOT9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66532-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66532-1-Ig (ACOT9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 66532-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66532-1-Ig (ACOT9 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 66532-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66532-1-Ig (ACOT9 antibody) at dilution of 1:200 (under 40x lens).

ACOT9 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66532-1-Ig

Clone No.3F10G5

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

ACATE2, ACOT9, Acyl CoA thioester hydrolase 9, acyl CoA thioesterase 9, CGI 16, MT ACT48

---

Tested Applications

• Positive WB detected in: HEK-293 cells, RAW 264.7 cells, Jurkat cells, HSC-T6 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66532-1-Ig targets ACOT9 in WB, IHC, ELISA applications and shows reactivity with Human, Rat, mouse samples.

• Tested Reactivity: Human, Rat, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8884

  Product name: Recombinant human ACOT9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC012573

  Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG

• Full Name: acyl-CoA thioesterase 9
• Calculated Molecular Weight: 24 kDa, 49 kDa
• Observed Molecular Weight: 43-50 kDa
• GenBank Accession Number: BC012573
• Gene Symbol: ACOT9
• Gene ID (NCBI): 23597
• RRID: AB_2881895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y305
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma; Authors - Qifan Hu