ACOT9 Monoclonal antibody, PBS Only

• 

  WB analysis using 66532-1-Ig (same clone as 66532-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66532-1-Ig (ACOT9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66532-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66532-1-Ig (same clone as 66532-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66532-1-Ig (ACOT9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66532-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66532-1-Ig (same clone as 66532-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66532-1-Ig (ACOT9 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66532-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66532-1-Ig (same clone as 66532-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66532-1-Ig (ACOT9 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66532-1-PBS in a different storage buffer formulation.

ACOT9 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66532-1-PBS

Clone No.3F10G5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ACATE2, ACOT9, Acyl CoA thioester hydrolase 9, acyl CoA thioesterase 9, CGI 16, MT ACT48

---

Product Information

66532-1-PBS targets ACOT9 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Rat, mouse samples.

• Tested Reactivity: Human, Rat, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8884

  Product name: Recombinant human ACOT9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC012573

  Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG

• Full Name: acyl-CoA thioesterase 9
• Calculated Molecular Weight: 24 kDa, 49 kDa
• Observed Molecular Weight: 43-50 kDa
• GenBank Accession Number: BC012573
• Gene Symbol: ACOT9
• Gene ID (NCBI): 23597
• RRID: AB_2881895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y305
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa.