Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human ovarian cancer, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83731-2-RR targets ACOX1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1405 Product name: Recombinant human AOX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 275-660 aa of BC010425 Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL Predict reactive species |
| Full Name | acyl-Coenzyme A oxidase 1, palmitoyl |
| Calculated Molecular Weight | 74 kDa |
| Observed Molecular Weight | 70-74 kDa, 22 kDa |
| GenBank Accession Number | BC010425 |
| Gene Symbol | ACOX1 |
| Gene ID (NCBI) | 51 |
| RRID | AB_3671331 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15067 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ACOX1 antibody 83731-2-RR | Download protocol |
| IHC protocol for ACOX1 antibody 83731-2-RR | Download protocol |
| WB protocol for ACOX1 antibody 83731-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACOX1 Recombinant monoclonal antibody (240754E3), catalog number 83731-2-RR, has 7 citations published in Phytomedicine, Nutrients, International Immunopharmacology, Biochimica et Biophysica Acta Molecular Basis of Disease, Journal of Cellular and Molecular Medicine, FEBS Journal, and Biology Direct. The research fields span alcohol-associated liver disease, acute and chronic kidney injury, triple-negative breast cancer, pulmonary ischemia-reperfusion injury, and peroxisome-related signaling in digestive system cancers.
| Species | Application | Title |
|---|---|---|
Phytomedicine 6-shogaol suppresses MAPK14 to attenuate endoplasmic reticulum stress and alleviate alcohol-associated liver disease. | ||
Nutrients Integrated Proteomics and Metabolomics Reveal the Direct Hepatic Protection of Propionate Against Alcoholic Liver Disease via the RGN-PPARα Pathway. | ||
Int Immunopharmacol N-acetylglucosamine ameliorates the transition from acute kidney injury to chronic kidney disease by reducing the accumulation of lipid droplets. | ||
Biochim Biophys Acta Mol Basis Dis TRIM34 inhibits triple-negative breast cancer progression by attenuating fatty acid synthesis via facilitating FASN ubiquitination | ||
J Cell Mol Med Succinate Accumulation Accelerates Oxidative Stress to Promote Pulmonary Epithelial Cell Apoptosis During Lung Ischemia-Reperfusion Injury | ||
FEBS J SLC38A6 expression in renal tubular cells accelerates cisplatin-induced acute kidney injury by promoting cell apoptosis. |
