ACP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ACP1 Recombinant monoclonal antibody, PBS Only (86817-1-PBS)

• 

  WB analysis using 86817-1-RR (same clone as 86817-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86817-1-RR (ACP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86817-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 86817-1-RR (same clone as 86817-1-PBS)

  WB result of ACP1 antibody (86817-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACP1 transfected HepG2 cells. This data was developed using the same antibody clone with 86817-1-PBS in a different storage buffer formulation.

• 

  IF Staining of 4T1 using 86817-1-RR (same clone as 86817-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed 4T1 cells using ACP1 antibody (86817-1-RR, Clone: 251838C3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86817-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86817-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86817-1-RR against Human ACP1 were performed. The affinity constant is below 1 pM.

ACP1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86817-1-PBS

Clone No.251838C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ACP 1, EC:3.1.3.2, EC:3.1.3.48, HAAP, LMW PTP

---

Product Information

86817-1-PBS targets ACP1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17539

  Product name: Recombinant human ACP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-102 aa of BC007422

  Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR

• Full Name: acid phosphatase 1, soluble
• Calculated Molecular Weight: 158 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC007422
• Gene Symbol: ACP1
• Gene ID (NCBI): 52
• RRID: AB_3745140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Acid phosphatase 1 (ACP1) is a low-molecular-weight phosphotyrosine protein phosphatase known to participate in various cellular processes, including signal transduction, proliferation, and metabolism. It functions by dephosphorylating tyrosine-phosphorylated proteins, thereby modulating receptor-mediated signaling pathways.