ACSM5 Recombinant monoclonal antibody

ACSM5 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 84444-1-RR
Clone No.241400E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

241400E7, ACSM 5, Acyl-CoA synthetase medium-chain family member 5, Acyl-coenzyme A synthetase ACSM5, mitochondrial, EC:6.2.1.2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue, human kidney tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84444-1-RR targets ACSM5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9373

Product name: Recombinant human ACSM5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-208 aa of BC016703

Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR

Predict reactive species
Full Name acyl-CoA synthetase medium-chain family member 5
Calculated Molecular Weight 208 aa, 23 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC016703
Gene Symbol ACSM5
Gene ID (NCBI) 54988
RRIDAB_3671969
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ6NUN0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for ACSM5 antibody 84444-1-RRDownload protocol
IHC protocol for ACSM5 antibody 84444-1-RRDownload protocol
FC protocol for ACSM5 antibody 84444-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...