ACTL7B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACTL7B Polyclonal antibody, PBS Only (13537-1-PBS)

• 

  WB analysis of human testis using 13537-1-AP (same clone as 13537-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 13537-1-AP (ACTL7B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13537-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13537-1-AP (same clone as 13537-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13537-1-AP (ACTL7B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13537-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 13537-1-AP (same clone as 13537-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13537-1-AP (ACTL7B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13537-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13537-1-AP (same clone as 13537-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13537-1-AP (ACTL7B antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13537-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13537-1-AP (same clone as 13537-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13537-1-AP (ACTL7B antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13537-1-PBS in a different storage buffer formulation.

ACTL7B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13537-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13537-1-PBS targets ACTL7B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4460

  Product name: Recombinant human ACTL7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-415 aa of BC033789

  Sequence: MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC

• Full Name: actin-like 7B
• Calculated Molecular Weight: 415 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC033789
• Gene Symbol: ACTL7B
• Gene ID (NCBI): 10880
• RRID: AB_2223776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y614
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACTL7B is also named as actin-like-7-beta. The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. The ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. Diseases associated with ACTL7B include Dysautonomia and Hypertensive Nephropathy. An important paralog of this gene is ACTL7A. ACTL7B can be detected as 45 kDa.