Use Able AI chat for product recommendations

ACTN2 Monoclonal antibody

ACTN2 Monoclonal Antibody for WB, ELISA

Cat No. 68223-1-Ig
Clone No. 1D5F9
Publications (3)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit and More (1)

Applications

WB, IHC, ELISA

actinin, alpha 2, ACTN2, Alpha actinin 2, CMD1AA, F actin cross linking protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ACTN2 in ?

Tested Applications

Positive WB detected inpig heart tissue, rat colon tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue, pig colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68223-1-Ig targets ACTN2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5578

Product name: Recombinant human ACTN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-301 aa of BC051770

Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI

Predict reactive species
Full Name actinin, alpha 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight 103 kDa
GenBank Accession NumberBC051770
Gene Symbol ACTN2
Gene ID (NCBI) 88
RRIDAB_2935311
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).

Protocols

Product Specific Protocols
WB protocol for ACTN2 antibody 68223-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ACTN2 Monoclonal antibody (1D5F9), catalog number 68223-1-Ig, has 3 citations. These appear in Cell Death & Differentiation, iScience, and Frontiers in Molecular Neuroscience. The research fields span pancreatic cancer tumorigenicity (Pax6 sumoylation), hypertension-induced myocardial injury involving calcium ion transport, and intracranial aneurysms related to vascular smooth muscle cell growth and inflammation. Applications cited include WB and IHC across human, mouse, and rat species.

SpeciesApplicationTitle
WB

Cell Death Differ

Inhibition of Pax6 sumoylation suppresses the tumorigenicity of pancreatic cancer cells

Authors - Yuan Xiao
mouseWB

iScience

Exercise training affects calcium ion transport by downregulating the CACNA2D1 protein to reduce hypertension-induced myocardial injury in mice

Authors - Shan Gao
human, ratWB,IHC

Front Mol Neurosci

ACTN2, regulated by PRDM9, affects the growth and inflammation of vascular smooth muscle cells by interacting with PDLIM1 in intracranial aneurysms.

Authors - Guangxu Zhang
  • KO Validated
Loading...
||
New chat

Able™

正在加载,请稍候...