ACTN2 Monoclonal antibody, PBS Only

ACTN2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68223-1-PBS
Clone No.1D5F9

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

actinin, alpha 2, ACTN2, Alpha actinin 2, CMD1AA, F actin cross linking protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68223-1-PBS targets ACTN2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5578

Product name: Recombinant human ACTN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-301 aa of BC051770

Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI

Predict reactive species
Full Name actinin, alpha 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight 103 kDa
GenBank Accession NumberBC051770
Gene Symbol ACTN2
Gene ID (NCBI) 88
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35609
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).

Loading...
||
New chat Able
正在加载,请稍候...