ACVR1B Recombinant monoclonal antibody

ACVR1B Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83026-6-RR
Clone No.230260C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Activin receptor-like kinase 4, Activin receptor type-1B, Activin receptor type 1B, Activin receptor like kinase 4, activin A receptor, type IB

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, HepG2 cells, HEK-293 cells
Positive IHC detected inrat brain tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83026-6-RR targets ACVR1B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0129

Product name: Recombinant human ACVR1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 211-448 aa of BC000254

Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

Predict reactive species
Full Name activin A receptor, type IB
Calculated Molecular Weight 57 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC000254
Gene Symbol ACVR1B
Gene ID (NCBI) 91
RRIDAB_3670766
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36896
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444).

Protocols

Product Specific Protocols
WB protocol for ACVR1B antibody 83026-6-RRDownload protocol
IHC protocol for ACVR1B antibody 83026-6-RRDownload protocol
FC protocol for ACVR1B antibody 83026-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...