ADAM10 Monoclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 66620-1-Ig (same clone as 66620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66620-1-Ig (ADAM10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66620-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66620-1-Ig (same clone as 66620-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66620-1-Ig (ADAM10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66620-1-Ig (same clone as 66620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66620-1-Ig (ADAM10 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66620-1-Ig (same clone as 66620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66620-1-Ig (ADAM10 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66620-1-PBS in a different storage buffer formulation.

ADAM10 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66620-1-PBS

Clone No.2A6B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ADAM 10, Disintegrin and metalloproteinase domain-containing protein 10, EC:3.4.24.81, KUZ, MADM

---

Product Information

66620-1-PBS targets ADAM10 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23062

  Product name: Recombinant human ADAM10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 306-512 aa of BC126253

  Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV

• Full Name: ADAM metallopeptidase domain 10
• Calculated Molecular Weight: 748 aa, 84 kDa
• Observed Molecular Weight: 90-95 kDa
• GenBank Accession Number: BC126253
• Gene Symbol: ADAM10
• Gene ID (NCBI): 102
• RRID: AB_2881980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14672
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179).