ADAM11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAM11 Polyclonal antibody, PBS Only (32970-1-PBS)

• 

  WB analysis using 32970-1-AP (same clone as 32970-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32970-1-AP (ADAM11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32970-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 32970-1-AP (same clone as 32970-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32970-1-AP (ADAM11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32970-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 32970-1-AP (same clone as 32970-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using ADAM11 antibody (32970-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 32970-1-PBS in a different storage buffer formulation.

ADAM11 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32970-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ADAM 11, Disintegrin and metalloproteinase domain-containing protein 11, MDC, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

---

Product Information

32970-1-PBS targets ADAM11 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35877

  Product name: Recombinant human ADAM11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-300 aa of NM_001318933

  Sequence: STCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ

• Full Name: ADAM metallopeptidase domain 11
• Calculated Molecular Weight: 83kDa
• Observed Molecular Weight: 83 kDa
• GenBank Accession Number: NM_001318933
• Gene Symbol: ADAM11
• Gene ID (NCBI): 4185
• RRID: AB_3742808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75078
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAM11 (A Disintegrin And Metalloprotease 11) is a non-catalytic, transmembrane member of the ADAM family. Although it retains the prototypical multi-domain architecture (signal peptide ‑ pro‑domain ‑ metalloprotease-like ‑ disintegrin ‑ cysteine-rich ‑ EGF-like ‑ TM ‑ cytoplasmic tail), it lacks the consensus HEXGHXXGXXHD zinc-binding motif, rendering it proteolytically inactive . Instead, ADAM11 functions as a cell-adhesion and signalling scaffold. (PMID: 31236626)