• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ADAM12 Polyclonal antibody

ADAM12 Polyclonal Antibody for FC (Intra)
Cat No. CL488-14139

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

MLTN, Meltrin-alpha, MCMP, EC:3.4.24.-, Disintegrin and metalloproteinase domain-containing protein 12

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14139 targets ADAM12 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5206

Product name: Recombinant human ADAM12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-350 aa of BC060804

Sequence: VSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELG

Predict reactive species
Full Name ADAM metallopeptidase domain 12
Calculated Molecular Weight 100 kDa
Observed Molecular Weight 90-100 kDa, 70-80 kDa
GenBank Accession NumberBC060804
Gene Symbol ADAM12
Gene ID (NCBI) 8038
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43184
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ADAM12, also named as MLTN and Meltrin-alpha, is involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. ADAM12 is expressed in human malignant tumors(PMID:17355265). ADAM12's ability to degrade extracellular matrix components likely allows it to detach cancer cells from the basement membrane and assist them on their route to metastasis. But the protein's role not just as a biomarker of breast cancer but as a gateway to cancer cell migration is only now being understood. ADAM12 has 2 isoforms with the calculated molecular mass of 100 and 80 kDa, and this antibody can recognize all isoforms of ADAM12. ADAM12 has 4 forms: 120kDa full-length form, 90kd mature (processed form that lack the prodomain), 50-68kDa degradation product and 27kDa prodomain.

Loading...
||
New chat

Able

正在加载,请稍候...