ADAM17 Recombinant monoclonal antibody, PBS Only (Detector)

ADAM17 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84292-4-PBS
Clone No.241305A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test

241305A2, ADAM 17, cSVP, Disintegrin and metalloproteinase domain-containing protein 17, EC:3.4.24.86

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84292-4-PBS targets ADAM17 as part of a matched antibody pair:

MP01169-3: 84292-3-PBS capture and 84292-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32418

Product name: Recombinant human ADAM17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 693-824 aa of BC136783

Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Predict reactive species
Full Name ADAM metallopeptidase domain 17
Calculated Molecular Weight 824 aa, 93 kDa
Observed Molecular Weight100-130 kDa
GenBank Accession NumberBC136783
Gene Symbol ADAM17
Gene ID (NCBI) 6868
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP78536
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).

Loading...
||
New chat Able
正在加载,请稍候...