ADAM17 Recombinant monoclonal antibody

ADAM17 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 84292-4-RR
Clone No.241305A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

241305A2, ADAM 17, cSVP, Disintegrin and metalloproteinase domain-containing protein 17, EC:3.4.24.86

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HCT 116 cells, HUVEC cells, SW480 cells, HeLa cells, RAW 264.7 cells
Positive IHC detected inhuman rectal cancer tissue, human tonsil tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHCT 116 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84292-4-RR targets ADAM17 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32418

Product name: Recombinant human ADAM17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 693-824 aa of BC136783

Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Predict reactive species
Full Name ADAM metallopeptidase domain 17
Calculated Molecular Weight 824 aa, 93 kDa
Observed Molecular Weight100-130 kDa
GenBank Accession NumberBC136783
Gene Symbol ADAM17
Gene ID (NCBI) 6868
RRIDAB_3671836
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP78536
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).

Protocols

Product Specific Protocols
FC protocol for ADAM17 antibody 84292-4-RRDownload protocol
IHC protocol for ADAM17 antibody 84292-4-RRDownload protocol
WB protocol for ADAM17 antibody 84292-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...