ADAM23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAM23 Polyclonal antibody, PBS Only (32969-1-PBS)

• 

  WB analysis using 32969-1-AP (same clone as 32969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32969-1-AP (ADAM23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32969-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32969-1-AP (same clone as 32969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32969-1-AP (ADAM23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32969-1-PBS in a different storage buffer formulation.

ADAM23 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32969-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ADAM 23, Disintegrin and metalloproteinase domain-containing protein 23, MDC3, MDC-3, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3

---

Product Information

32969-1-PBS targets ADAM23 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35744

  Product name: Recombinant human ADAM23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 342-488 aa of BC132765

  Sequence: NTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGG

• Full Name: ADAM metallopeptidase domain 23
• Calculated Molecular Weight: 832 aa, 92 kDa
• Observed Molecular Weight: 92 kDa, 70 kDa
• GenBank Accession Number: BC132765
• Gene Symbol: ADAM23
• Gene ID (NCBI): 8745
• RRID: AB_3742807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75077
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAM23 (A disintegrin and metalloprotease protein 23), also known as MDC-3 (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) is a transmembrane type I glycoprotein involved with the development and maintenance of the nervous system, including neurite outgrowth, neuronal adhesion and differentiation and regulation of synaptic transmission. In addition, ADAM23 seems to participate in immune response and tumor establishment through interaction with different members of integrin receptors (PMID: 19692335). Two forms of ADAM23 have been previously described in primary cerebellar granule cells as an unprocessed precursor (100 kDa) and mature (70 kDa) protein, respectively (PMID: 29792904).