ADAM8 Monoclonal antibody

ADAM8 Monoclonal Antibody for WB, FC, ELISA
Cat No. 68113-1-Ig
Clone No.3A12H2

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, FC, ELISA

MS2, EC:3.4.24.-, Disintegrin and metalloproteinase domain-containing protein 8, Cell surface antigen MS2, CD156a

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, HaCaT cells, A431 cells, pig stomach tissue, pig pancreas tissue
Positive FC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68113-1-Ig targets ADAM8 in WB, FC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17262

Product name: Recombinant human ADAM8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 145-494 aa of BC115404

Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN

Predict reactive species
Full Name ADAM metallopeptidase domain 8
Calculated Molecular Weight 824 aa, 89 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC115404
Gene Symbol ADAM8
Gene ID (NCBI) 101
RRIDAB_2923642
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP78325
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM8 is a type I transmembrane (TM) glycoprotein consisting of an N-terminal prodomain, followed by a metalloproteinase-, disintegrin (DIS)-, cysteine-rich-, epidermal growth factor (EGF)-like- and TM domain and a cytoplasmic tail. Expression levels of ADAM8 in normal tissue are typically low and limited to a few distinct cell types in the lymphatic organs as components of the immune system, the central nervous system, bone, and the lung. This antibody can be used to detect endogenous ADAM8 with an apparent molecular weight of 90 kDa (the calculated MW ). ADAM8 also can be detectable as a band with a molecular weight (MW) of 98 kDa, slightly larger than the calculated MW (90 kDa) (PMID:11050116).

Protocols

Product Specific Protocols
FC protocol for ADAM8 antibody 68113-1-IgDownload protocol
WB protocol for ADAM8 antibody 68113-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...