ADAM8 Monoclonal antibody, PBS Only

ADAM8 Monoclonal Antibody for WB, FC, Indirect ELISA
Cat No. 68113-1-PBS
Clone No.3A12H2

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, FC, Indirect ELISA

MS2, EC:3.4.24.-, Disintegrin and metalloproteinase domain-containing protein 8, Cell surface antigen MS2, CD156a

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68113-1-PBS targets ADAM8 in WB, FC, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17262

Product name: Recombinant human ADAM8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 145-494 aa of BC115404

Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN

Predict reactive species
Full Name ADAM metallopeptidase domain 8
Calculated Molecular Weight 824 aa, 89 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC115404
Gene Symbol ADAM8
Gene ID (NCBI) 101
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP78325
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADAM8 is a type I transmembrane (TM) glycoprotein consisting of an N-terminal prodomain, followed by a metalloproteinase-, disintegrin (DIS)-, cysteine-rich-, epidermal growth factor (EGF)-like- and TM domain and a cytoplasmic tail. Expression levels of ADAM8 in normal tissue are typically low and limited to a few distinct cell types in the lymphatic organs as components of the immune system, the central nervous system, bone, and the lung. This antibody can be used to detect endogenous ADAM8 with an apparent molecular weight of 90 kDa (the calculated MW ). ADAM8 also can be detectable as a band with a molecular weight (MW) of 98 kDa, slightly larger than the calculated MW (90 kDa) (PMID:11050116).

Loading...
||
New chat

Able

正在加载,请稍候...