ADAMDEC1 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

ADAMDEC1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 82985-5-PBS
Clone No.230367D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

A disintegrin and metalloproteinase domain-like protein decysin-1, ADAM DEC1, ADAMDEC 1, ADAM-like protein decysin-1, EC:3.4.24.-

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82985-5-PBS targets ADAMDEC1 as part of a matched antibody pair:

MP00007-1: 82985-5-PBS capture and 82985-4-PBS detection (validated in Cytometric bead array)

MP00007-2: 82985-5-PBS capture and 82985-3-PBS detection (validated in Cytometric bead array)

MP00007-3: 82985-2-PBS capture and 82985-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12265

Product name: Recombinant human ADAMDEC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 56-470 aa of BC074877

Sequence: REIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Predict reactive species
Full Name ADAM-like, decysin 1
Calculated Molecular Weight 470 aa, 53 kDa
GenBank Accession NumberBC074877
Gene Symbol ADAMDEC1
Gene ID (NCBI) 27299
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15204
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...