ADAMTS12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAMTS12 Polyclonal antibody, PBS Only (24934-1-PBS)

• 

  WB analysis of mouse placenta using 24934-1-AP (same clone as 24934-1-PBS)

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 24934-1-AP (ADAMTS12 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24934-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 24934-1-AP (same clone as 24934-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24934-1-AP (ADAMTS12 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24934-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 24934-1-AP (same clone as 24934-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using ADAMTS12 antibody (24934-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 24934-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ADAMTS12 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24934-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24934-1-PBS targets ADAMTS12 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20712

  Product name: Recombinant human ADAMTS12 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-229 aa of BC058841

  Sequence: MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 12
• Calculated Molecular Weight: 178 kDa
• Observed Molecular Weight: 155 kDa
• GenBank Accession Number: BC058841
• Gene Symbol: ADAMTS12
• Gene ID (NCBI): 81792
• RRID: AB_2879806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58397
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAMTS12(A disintegrin and metalloproteinase with thrombospondin motifs 12) is also named as AT12, ADAM-TS12, PRO4389 and belongs to the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. ADAMTS7 and ADAMTS12 appear to be potent negative regulators of endplate cartilage development(PMID:22247065). This protein has 3 isoforms produced by alternative splicing. The full length protein has 14 glycosylation sites.