ADAMTS19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAMTS19 Polyclonal antibody, PBS Only (32890-1-PBS)

• 

  IHC staining of mouse kidney using 32890-1-AP (same clone as 32890-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32890-1-AP (ADAMTS19 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32890-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 32890-1-AP (same clone as 32890-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32890-1-AP (ADAMTS19 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32890-1-PBS in a different storage buffer formulation.

ADAMTS19 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 32890-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

A disintegrin and metalloproteinase with thrombospondin motifs 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC:3.4.24.-

---

Product Information

32890-1-PBS targets ADAMTS19 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36946

  Product name: Recombinant human ADAMTS19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 580-750 aa of NM_133638

  Sequence: CQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDLGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKCPGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGY

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 19
• Calculated Molecular Weight: 134kDa
• GenBank Accession Number: NM_133638
• Gene Symbol: ADAMTS19
• Gene ID (NCBI): 171019
• RRID: AB_3742778
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TE59
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAMTS19 encodes a member of the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin motifs) protein family with emerging roles in carcinogenesis and metastasis. ADAMTS shares several distinct protein modules including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The promoter of ADAMTS19 is targeted by hypermethylation in a significant proportion of gastrointestinal cancers, particularly in BRAF-mutant cancers, and that this hypermethylation associates with transcriptional downregulation and reduces the in vitro migration capabilities of Colorectal cancer cells (PMID: 26634009).