Tested Applications
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84476-6 targets ADAMTS2 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34957 Product name: Recombinant human ADAMTS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1091-1211 aa of NM_014244 Sequence: KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF Predict reactive species |
| Full Name | ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| Calculated Molecular Weight | 135 kDa |
| Observed Molecular Weight | 110~130 kDa |
| GenBank Accession Number | NM_014244 |
| Gene Symbol | ADAMTS2 |
| Gene ID (NCBI) | 9509 |
| RRID | AB_3747570 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95450 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
A disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) is a metalloproteinase that plays a key role in the processing of fibrillar procollagen precursors into mature collagen molecules by excising the amino-propeptide. ADAMTS-2 can, like the procollagen C-proteinases, be regulated by transforming growth factor-β1 (TGF-β1), with implications for mechanisms whereby this growth factor effects net increases in formation of extracellular matrix. Mutations in the ADAMTS-2 gene cause dermatosparaxis in human (dermatosparactic type of Ehlers-Danlos syndrome, also known as Ehlers-Danlos syndrome type VIIC). Human ADAMTS-2 has eight potential sites for Asn-linked glycosylation and other mammals (PMID: 16046392, 12646579).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 ADAMTS2 antibody CL488-84476-6 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

