ADAMTSL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAMTSL3 Polyclonal antibody, PBS Only (26653-1-PBS)

• 

  IHC staining of mouse kidney using 26653-1-AP (same clone as 26653-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26653-1-AP (ADAMTSL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26653-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 26653-1-AP (same clone as 26653-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26653-1-AP (ADAMTSL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26653-1-PBS in a different storage buffer formulation.

ADAMTSL3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26653-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

ADAMTS like 3, ADAMTS like protein 3, ADAMTSL 3, KIAA1233, Punctin 2

---

Product Information

26653-1-PBS targets ADAMTSL3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24488

  Product name: Recombinant human ADAMTSL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 616-720 aa of BC128389

  Sequence: TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG

• Full Name: ADAMTS-like 3
• Calculated Molecular Weight: 1691 aa, 189 kDa
• GenBank Accession Number: BC128389
• Gene Symbol: ADAMTSL3
• Gene ID (NCBI): 57188
• RRID: AB_3742198
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82987
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAMTSL3 (ADAMTS-Like Protein 3) is a member of the ADAMTSL family of matricellular proteins, which are involved in extracellular matrix (ECM) remodeling and regulation of various biological processes, including cardiac function, cartilage development, and inflammation. (PMID: 38324186)