Product Information
32965-1-PBS targets ADAMTSL5 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37537 Product name: Recombinant human ADAMTSL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 370-481 aa of NM_213604 Sequence: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCPG Predict reactive species |
| Full Name | ADAMTS-like 5 |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | NM_213604 |
| Gene Symbol | ADAMTSL5 |
| Gene ID (NCBI) | 339366 |
| RRID | AB_3742806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6ZMM2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ADAMTSL5 encodes ADAMTS-like protein 5, a secreted extracellular matrix protein that binds heparin and microfibrils and is involved in extracellular matrix organization. It is located in the extracellular region, extracellular space, extracellular matrix, elastic fiber, and Golgi apparatus, placing it in the secretory route and at matrix-associated sites where it can engage extracellular structural components.

