ADCY8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADCY8 Polyclonal antibody, PBS Only (30171-1-PBS)

• 

  WB analysis using 30171-1-AP (same clone as 30171-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 30171-1-AP (ADCY8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30171-1-PBS in a different storage buffer formulation.

ADCY8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30171-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30171-1-PBS targets ADCY8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32901

  Product name: Recombinant human ADCY8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-715 aa of NM_001115

  Sequence: GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN

• Full Name: adenylate cyclase 8 (brain)
• Calculated Molecular Weight: 140kd
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: NM_001115
• Gene Symbol: ADCY8
• Gene ID (NCBI): 114
• RRID: AB_2935523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40145
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADCY8 Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence. The antibody is specific to ADCY8.