Use Able AI chat for product recommendations

ADGB Polyclonal antibody, PBS Only

ADGB Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 31756-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

C6orf103, Androglobin, Calpain 7 like protein, Calpain-7-Like Protein, CAPN7L

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31756-1-PBS targets ADGB in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36246

Product name: Recombinant human C6orf103 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 550-700 aa of NM_024694

Sequence: ETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGAL

Predict reactive species
Full Name chromosome 6 open reading frame 103
Calculated Molecular Weight189kDa
Observed Molecular Weight235 kDa
GenBank Accession NumberNM_024694
Gene Symbol C6orf103
Gene ID (NCBI) 79747
RRIDAB_3742473
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ8N7X0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADGB (Androglobin) is an evolutionarily conserved member of the globin protein family. It is specifically and highly expressed in spermatogenic cells (particularly sperm cells) of mammalian testes and in ciliated cells across various tissues. The ADGB protein possesses a unique structure, comprising a globin domain and a calmodulin-binding domain, suggesting its potential role in integrating gas (such as oxygen) sensing with calcium ion signaling functions. Current research indicates that ADGB plays a critical role in spermatogenesis within the male reproductive system, as well as in the formation and functional maintenance of cilia. Its functional deficiency may lead to abnormal sperm morphology and motility defects, thereby affecting male fertility. The target protein ADGB has a size of 235 kDa. This protein is unstable and prone to degradation, with degradation bands observed at 135 kDa, 70 kDa, and 55 kDa. (PMID: 36995441)

Loading...
||
New chat

Able

正在加载,请稍候...