ADM2 Polyclonal antibody

ADM2 Polyclonal Antibody for IHC, ELISA
Cat No. 23781-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF, IHC, ELISA

ADM2, adrenomedullin 2, AM2, IMDL Intermedin short, IMDS, Intermedin, Intermedin long

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman stomach tissue, mouse stomach tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

23781-1-AP targets ADM2 in IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20548

Product name: Recombinant human ADM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-148 aa of BC012864

Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

Predict reactive species
Full Name adrenomedullin 2
Calculated Molecular Weight 16 kDa
GenBank Accession NumberBC012864
Gene Symbol ADM2
Gene ID (NCBI) 79924
RRIDAB_2879322
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ7Z4H4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADM2 also named as adrenomedullin 2 or IMDS is a 148 amino-acid secreted protein, which belongs to adrenomedullin family of calcitonin-related peptide hormones and is expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. ADM2 activates the cAMP-dependent pathway and may play a role in regulating gastrointestinal and cardiovascular bioactivities. ADM2 play a role in the regulation of peripheral tissues by calcitonin receptor-like receptor.

Protocols

Product Specific Protocols
IHC protocol for ADM2 antibody 23781-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Front Immunol

Adrenomedullin Expression Is Associated With the Severity and Poor Prognosis of Interstitial Lung Disease in Dermatomyositis Patients.

Authors - Lifang Ye
Loading...
||
New chat Able
正在加载,请稍候...