ADM2 Polyclonal antibody

• 

  IHC staining of human stomach using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse stomach using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23781-1-AP (ADM2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of mouse heart using 23781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23781-1-AP (ADM2 Antibody) at dilution of 1:200 (under 40x lens).

ADM2 Polyclonal Antibody for IHC, ELISA

Cat No. 23781-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF, IHC, ELISA

Synonyms

ADM2, adrenomedullin 2, AM2, IMDL Intermedin short, IMDS, Intermedin, Intermedin long

---

Tested Applications

• Positive IHC detected in: human stomach tissue, mouse stomach tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

23781-1-AP targets ADM2 in IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20548

  Product name: Recombinant human ADM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC012864

  Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

• Full Name: adrenomedullin 2
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC012864
• Gene Symbol: ADM2
• Gene ID (NCBI): 79924
• RRID: AB_2879322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q7Z4H4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADM2 also named as adrenomedullin 2 or IMDS is a 148 amino-acid secreted protein, which belongs to adrenomedullin family of calcitonin-related peptide hormones and is expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. ADM2 activates the cAMP-dependent pathway and may play a role in regulating gastrointestinal and cardiovascular bioactivities. ADM2 play a role in the regulation of peripheral tissues by calcitonin receptor-like receptor.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Front Immunol; Adrenomedullin Expression Is Associated With the Severity and Poor Prognosis of Interstitial Lung Disease in Dermatomyositis Patients.; Authors - Lifang Ye