ADM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADM2 Polyclonal antibody, PBS Only (23781-1-PBS)

• 

  IHC staining of human stomach using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23781-1-AP (ADM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23781-1-AP (ADM2 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 23781-1-AP (same clone as 23781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23781-1-AP (ADM2 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 23781-1-PBS in a different storage buffer formulation.

ADM2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 23781-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

23781-1-PBS targets ADM2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20548

  Product name: Recombinant human ADM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC012864

  Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

• Full Name: adrenomedullin 2
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC012864
• Gene Symbol: ADM2
• Gene ID (NCBI): 79924
• RRID: AB_2879322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q7Z4H4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADM2 also named as adrenomedullin 2 or IMDS is a 148 amino-acid secreted protein, which belongs to adrenomedullin family of calcitonin-related peptide hormones and is expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. ADM2 activates the cAMP-dependent pathway and may play a role in regulating gastrointestinal and cardiovascular bioactivities. ADM2 play a role in the regulation of peripheral tissues by calcitonin receptor-like receptor.