ADORA2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADORA2B Polyclonal antibody, PBS Only (21071-1-PBS)

• 

  WB analysis of mouse brain using 21071-1-AP (same clone as 21071-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21071-1-AP (ADORA2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21071-1-PBS in a different storage buffer formulation.

ADORA2B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21071-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

ADORA2, Adenosine receptor A2b, adenosine A2b receptor

---

Product Information

21071-1-PBS targets ADORA2B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15214

  Product name: Recombinant human ADORA2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-332 aa of BC025722

  Sequence: LSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

• Full Name: adenosine A2b receptor
• Calculated Molecular Weight: 332 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC025722
• Gene Symbol: ADORA2B
• Gene ID (NCBI): 136
• RRID: AB_2918069
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29275
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.