ADPRH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADPRH Polyclonal antibody, PBS Only (17911-1-PBS)

• 

  WB analysis using 17911-1-AP (same clone as 17911-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17911-1-AP (ADPRH antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17911-1-AP (same clone as 17911-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17911-1-AP (ADPRH Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17911-1-AP (same clone as 17911-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17911-1-AP (ADPRH Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 17911-1-AP (same clone as 17911-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17911-1-AP (ADPRH Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17911-1-AP (same clone as 17911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17911-1-AP (ADPRH antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17911-1-AP (same clone as 17911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17911-1-AP (ADPRH antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17911-1-PBS in a different storage buffer formulation.

ADPRH Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17911-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17911-1-PBS targets ADPRH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12311

  Product name: Recombinant human ADPRH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC063883

  Sequence: MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL

• Full Name: ADP-ribosylarginine hydrolase
• Calculated Molecular Weight: 357 aa, 40 kDa
• Observed Molecular Weight: 36-39 kDa
• GenBank Accession Number: BC063883
• Gene Symbol: ADPRH
• Gene ID (NCBI): 141
• RRID: AB_2878466
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54922
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.