Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Perilipin-2 Polyclonal antibody

Perilipin-2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15294-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, IP, ELISA

ADFP, Adipophilin, Adipose differentiation-related protein, ADRP, ADRP/Perilipin 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, K-562 cells, 3T3-L1 cells, NIH/3T3 cells, mouse liver tissue
Positive IHC detected inhuman liver cancer tissue, human renal cell carcinoma tissue, human liver tissue, human colon cancer tissue, human prostate cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inoleic acid treated HeLa cells

This antibody is not suitable for immunofluorescence staining of frozen sections.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:200-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15294-1-AP targets Perilipin-2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, monkey, zebrafish, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7539

Product name: Recombinant human ADRP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-437 aa of BC005127

Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH

Predict reactive species
Full Name adipose differentiation-related protein
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 45-48 kDa
GenBank Accession NumberBC005127
Gene Symbol Perilipin-2
Gene ID (NCBI) 123
RRIDAB_2878122
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99541
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases. This antibody is not suitable for immunofluorescence staining of frozen sections.

Protocols

Product Specific Protocols
IF protocol for Perilipin-2 antibody 15294-1-APDownload protocol
IHC protocol for Perilipin-2 antibody 15294-1-APDownload protocol
WB protocol for Perilipin-2 antibody 15294-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Nature

iPS-cell-derived microglia promote brain organoid maturation via cholesterol transfer

Authors - Dong Shin Park
humanIF

Nature

The role of NSP6 in the biogenesis of the SARS-CoV-2 replication organelle.

Authors - Simona Ricciardi
mouseIHC

Signal Transduct Target Ther

The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease

Authors - Chandana Thimme Gowda
mouse,humanIHC,IF

Cell Metab

Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.

Authors - Yi Fu
humanIF

Nat Metab

The Neurolipid Atlas: a lipidomics resource for neurodegenerative diseases.

Authors - Femke M Feringa
mouseIF

Nat Commun

Spliceosome component Usp39 contributes to hepatic lipid homeostasis through the regulation of autophagy

Authors - Donghai Cui

Reviews

    4.8 out of 5
Add a review

10 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Pauline (Verified Customer) (07-22-2026)

Very efficient staining on small lipid droplet

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/400
  • Cell Tissue Type: Adipose tissue

MALLIKARJUNA (Verified Customer) (11-13-2025)

good for western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: liver tissue

Samuel (Verified Customer) (07-31-2025)

I found this primary antibody to work quite well, at least from a Western blot perspective, (I have not tried any other applications using this particular antibody). The experimental results came out quite clean and there has been little to no non-specific banding patterns, which is very nice. Lastly, the standard 1:1000 primary antibody dilution I have used works just fine for my needs, which allows the vial to last a decent amount of time. Overall, I would recommend!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Christin (Verified Customer) (11-25-2024)

Excellent antibody for ICC and WB of human iPSC-derived microglia and macrophages

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Human iPSC-derived microglia and macrophages

Liliana (Verified Customer) (02-13-2024)

WORKS VERY WELL ON PH9, 1:2000 AND ON PH6, 1:1000

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: SKIN WITH SEBACCEUS ADENOMA
Perilipin-2 Antibody Immunohistochemistry validation (1:2000 dilution) in SKIN WITH SEBACCEUS ADENOMA (Cat no:15294-1-AP)

Christine (Verified Customer) (09-19-2023)

Tried on HEK293T cells treated with 300 uM oleic acid overnight to induce the formation of lipid droplets. This antibody decorates some droplets but was a bit weak. TIP47 antibody (10694-1-AP) performed better (clearer detection of the droplets) at the same concentration (1:100).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HEK293T

Kamal (Verified Customer) (07-05-2023)

Worked well when diluted with 1X PBS.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Mouse Liver tissue

Christin (Verified Customer) (03-09-2023)

Great antibody for WB with low background signal.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human iPSC-derived microglia and macrophages

Nick (Verified Customer) (04-20-2022)

Helped localize expression of Plin2

  • Applications: Western Blot, Immunoprecipitation, Cell culture
  • Cell Tissue Type: 3T3-L1

Boyan (Verified Customer) (05-09-2019)

Very good for WB

  • Applications: Western Blot,
  • Cell Tissue Type: MEF
Loading...
||
New chat

Able

正在加载,请稍候...